PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma203g00280.1
Common NameZOSMA_203G00280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 254aa    MW: 28776.7 Da    PI: 7.6914
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma203g00280.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.73e-23959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      k ien++nrqvtfskRr g+lKKAeELSvLCd ++++++  s+ k + y++
  Zosma203g00280.1  9 KMIENTTNRQVTFSKRRGGLLKKAEELSVLCDSQILLVMSTSNHKAFKYCT 59
                      68*****************************************99999986 PP

2K-box54.26.4e-1971168198
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       yq++ g +l++  +e++q++la   k + +L++e+R+++Ge+L++++++eL+ Le++Le   k +R+kK   + +q+ ++ kk ++ ++++++
  Zosma203g00280.1  71 YQSNAGIDLWNGPYEEMQKQLAEQFKINAELRKEIRQRMGEELDDIDIQELRLLEEDLEAKGKIVREKKFGKIGTQTTTSDKKVRSFRSQHNK 163
                       78888999************************************************************************************* PP

             K-box  94 Lrkkl 98 
                       L ++l
  Zosma203g00280.1 164 LVAQL 168
                       *9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.693161IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-34160IPR002100Transcription factor, MADS-box
CDDcd002654.85E-36280No hitNo description
SuperFamilySSF554559.55E-31291IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-24323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-201157IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.91184174IPR002487Transcription factor, K-box
PfamPF014863.7E-1185167IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRGKIEIKM IENTTNRQVT FSKRRGGLLK KAEELSVLCD SQILLVMSTS NHKAFKYCTP  60
STNIKQMIDR YQSNAGIDLW NGPYEEMQKQ LAEQFKINAE LRKEIRQRMG EELDDIDIQE  120
LRLLEEDLEA KGKIVREKKF GKIGTQTTTS DKKVRSFRSQ HNKLVAQLIH MEAMKGIPNY  180
GYLGHEMDEY KNAEAIGLAN VGEYDVETDD QNHYKSAPGL TNGATAAALA FRLQPNQPNL  240
HDMGYGLHDL RLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-15285176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-15285176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-15285176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-15285176MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A3e-15285176Myocyte-specific enhancer factor 2A
3kov_B3e-15285176Myocyte-specific enhancer factor 2A
3kov_I3e-15285176Myocyte-specific enhancer factor 2A
3kov_J3e-15285176Myocyte-specific enhancer factor 2A
3p57_A3e-15285176Myocyte-specific enhancer factor 2A
3p57_B3e-15285176Myocyte-specific enhancer factor 2A
3p57_C3e-15285176Myocyte-specific enhancer factor 2A
3p57_D3e-15285176Myocyte-specific enhancer factor 2A
3p57_I3e-15285176Myocyte-specific enhancer factor 2A
3p57_J3e-15285176Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PLQ10.0A0A0K9PLQ1_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57283552
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.18e-53MIKC_MADS family protein